D2TMS1 AF NFT
Probable Sec-independent protein translocase protein TatE
MOLNFT AF v1 smart contract in GenesisL1 blockchain:
0xBf7491af3407816DFa88a5EA4c82e8A2B1D721eDIPFS of NFT metadata:
bafybeif744hldebfw4q7ztjtoiela3lni24ncdag4nydwmwblpe7ob2pwy/metadata.jsonIPFS of structure file:
bafybeieo3n762wuqjadr2tdtq2qdizzc6hbg436qs3by5jwdga7rhn7yc4/AF-D2TMS1-F1-model_v2.pdbFirst NFT owner address (eip-55):
0x7E60B954e5d9c3fdcf523d6f27d5Ced1637C0C0DFirst NFT owner address (bech32):
genesis10estj489m8plmn6j84hj04ww693hcrqdaqn684Current NFT ID #458708 owner (web3):
First owner GALLERY | EVM EXPLORER | COSMOS EXPLORER
MOLNFT D2TMS1 research and analysis (ICN3D with VR)
FASTA sequences
>sp|D2TMS1|TATE_CITRI Probable Sec-independent protein translocase protein TatE OS=Citrobacter rodentium (strain ICC168) OX=637910 GN=tatE PE=3 SV=1 MGEISITKLLVIAALVVLLFGTKKLRTLGGDLGTAIKGFKKAMNDDDATAKRDADSGIQAEKLSHKE