A6W4N5 AF NFT
50S ribosomal protein L36 1
MOLNFT AF v1 smart contract in GenesisL1 blockchain:
0xBf7491af3407816DFa88a5EA4c82e8A2B1D721eDIPFS of NFT metadata:
bafybeihpw56jdhoesgpo2df2paa5blfe2umckcivehxfbzl2uifijegnna/metadata.jsonIPFS of structure file:
bafybeigefqlwfjorjtvriwv2oucuxrtdy5ladbdwbhuo5lts3hodg6p65q/AF-A6W4N5-F1-model_v2.pdbFirst NFT owner address (eip-55):
0xa3452b8cEc5f7d4aA7eA35d2483a9795B3ae3C17First NFT owner address (bech32):
genesis15dzjhr8vta754fl2xhfysw5hjke6u0qh5lqay6Current NFT ID #369694 owner (web3): First owner GALLERY | EVM EXPLORER | COSMOS EXPLORER
MOLNFT A6W4N5 research and analysis (ICN3D with VR)
FASTA sequences
>sp|A6W4N5|RL361_KINRD 50S ribosomal protein L36 1 OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) OX=266940 GN=rpmJ1 PE=3 SV=1 MKVRASLKSLKQKEGSIVVRRRGKTYVLNKRNPRWKARQG