Q5CHB0 AF NFT
Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial
MOLNFT AF v1 smart contract in GenesisL1 blockchain:
0xBf7491af3407816DFa88a5EA4c82e8A2B1D721eDIPFS of NFT metadata:
bafybeifr6gpqwayzxeul3sbij6nhtrxkihrtj3roaugjomjqc6wojxxni4/metadata.jsonIPFS of structure file:
bafybeih3zof6s4ntopc5xv2clsbwbwosqooarie363db46m2dufnusw3o4/AF-Q5CHB0-F1-model_v2.pdbFirst NFT owner address (eip-55):
0xa640C227040600dbC67F66f02Af7651c7D2D9822First NFT owner address (bech32):
genesis15eqvyfcyqcqdh3nlvmcz4am9r37jmxpzl06yrwCurrent NFT ID #72846 owner (web3):
First owner GALLERY | EVM EXPLORER | COSMOS EXPLORER
MOLNFT Q5CHB0 research and analysis (ICN3D with VR)
FASTA sequences
>sp|Q5CHB0|COQ4_CRYHO Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial OS=Cryptosporidium hominis OX=237895 GN=Chro.10049 PE=3 SV=1 MNKFTNLLIKRTASSLKGGDFRELFRKNYIPITQFEKVLLSVTSCVEGLKNPTDSNSVACITELTSNRALRKLQILMNSTPDGRRIIKNRPLIDSSKYSIKDLMAFPDDSLGRRYGEFLTTYNLEIDRAPVRYVNSEDLAYVLTRFRQVSLNDYK