Q3Z1Y0 AF NFT

OriC-binding nucleoid-associated protein

MOLNFT AF v1 smart contract in GenesisL1 blockchain:
0xBf7491af3407816DFa88a5EA4c82e8A2B1D721eD
IPFS of NFT metadata:
bafybeihwo63bf6rfrqh2d6ibi7mcmaeoxxnbygqxjgnx7cqyyesrhd3v5q/metadata.json
IPFS of structure file:
bafybeifwbiyjyhhyj3ph3q27lpkh5clc73fi56m3lnxvx42utziwx2av5m/AF-Q3Z1Y0-F1-model_v2.pdb
First NFT owner address (eip-55):
0xd2c31D05bD906536424255BF8dB91Fc13bB5ffFF
First NFT owner address (bech32):
genesis16tp36pdajpjnvsjz2klcmwglcyamtllljyg4yy
Current NFT ID #68804 owner (web3):

First owner GALLERY | EVM EXPLORER | COSMOS EXPLORER

MOLNFT Q3Z1Y0 research and analysis (ICN3D with VR)

FASTA sequences

>sp|Q3Z1Y0|CNU_SHISS OriC-binding nucleoid-associated protein OS=Shigella sonnei (strain Ss046) OX=300269 GN=cnu PE=3 SV=1 MTVQDYLLKFRKISSLESLEKLYDHLNYTLTDDQELINMYRAADHRRAELVSGGRLFDLGQVPKSVWHYVQ