Q3Z1Y0 AF NFT
OriC-binding nucleoid-associated protein
MOLNFT AF v1 smart contract in GenesisL1 blockchain:
0xBf7491af3407816DFa88a5EA4c82e8A2B1D721eDIPFS of NFT metadata:
bafybeihwo63bf6rfrqh2d6ibi7mcmaeoxxnbygqxjgnx7cqyyesrhd3v5q/metadata.jsonIPFS of structure file:
bafybeifwbiyjyhhyj3ph3q27lpkh5clc73fi56m3lnxvx42utziwx2av5m/AF-Q3Z1Y0-F1-model_v2.pdbFirst NFT owner address (eip-55):
0xd2c31D05bD906536424255BF8dB91Fc13bB5ffFFFirst NFT owner address (bech32):
genesis16tp36pdajpjnvsjz2klcmwglcyamtllljyg4yyCurrent NFT ID #68804 owner (web3):
First owner GALLERY | EVM EXPLORER | COSMOS EXPLORER
MOLNFT Q3Z1Y0 research and analysis (ICN3D with VR)
FASTA sequences
>sp|Q3Z1Y0|CNU_SHISS OriC-binding nucleoid-associated protein OS=Shigella sonnei (strain Ss046) OX=300269 GN=cnu PE=3 SV=1 MTVQDYLLKFRKISSLESLEKLYDHLNYTLTDDQELINMYRAADHRRAELVSGGRLFDLGQVPKSVWHYVQ