Q1CIG5 AF NFT
50S ribosomal protein L35
MOLNFT AF v1 smart contract in GenesisL1 blockchain:
0xBf7491af3407816DFa88a5EA4c82e8A2B1D721eDIPFS of NFT metadata:
bafybeigpzzxjqqtzsr4puspnivd7jpcqocvuzbw7am4lrtcjw4v4gfrzka/metadata.jsonIPFS of structure file:
bafybeihowrswx4t4nm6rfj7ulqij2xlsurzozpmz4ga3ky7xzt3rvgydca/AF-Q1CIG5-F1-model_v2.pdbFirst NFT owner address (eip-55):
0xfAEAF51Ab1C077b86505caA5d00c4937c9795c60First NFT owner address (bech32):
genesis1lt402x43cpmmseg9e2jaqrzfxlyhjhrqy345haCurrent NFT ID #369672 owner (web3):
First owner GALLERY | EVM EXPLORER | COSMOS EXPLORER
MOLNFT Q1CIG5 research and analysis (ICN3D with VR)
FASTA sequences
>sp|Q1CIG5|RL35_YERPN 50S ribosomal protein L35 OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=rpmI PE=3 SV=1 MPKIKTVRGAAKRFKKTANGGFKRKHANLRHILTKKATKRKRHLRPKGLVSKNDLGLVVACLPYA