P61935 AF NFT

UPF0228 protein MA_4223

MOLNFT AF v1 smart contract in GenesisL1 blockchain:
0xBf7491af3407816DFa88a5EA4c82e8A2B1D721eD
IPFS of NFT metadata:
bafybeicm3t4xinq4fgqke7cbduja4fccfipgqbpiycxm3edq3exmgesphy/metadata.json
IPFS of structure file:
bafybeif6rdpjohkvk6myzkruh5ndwfntsmqn7gnr6bhdrkhufz55csslrq/AF-P61935-F1-model_v2.pdb
First NFT owner address (eip-55):
0x772cDF339c71f2E91A7B5C3137d74bF9134420C6
First NFT owner address (bech32):
genesis1wukd7vuuw8ewjxnmtscn046tlyf5ggxxn39dc2
Current NFT ID #517224 owner (web3):

First owner GALLERY | EVM EXPLORER | COSMOS EXPLORER

MOLNFT P61935 research and analysis (ICN3D with VR)

FASTA sequences

>sp|P61935|Y4223_METAC UPF0228 protein MA_4223 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) OX=188937 GN=MA_4223 PE=3 SV=1 MNKISKVVVVFIALLTFLALMMQSQEVKTPGLLIQFENETSEAEVKAILENYDIPVNYTIDYNSNIGRGMYYIEVDEDKIYELRKDENWTSVVEIKKGNYNIIMLSEEFVPDENVLAMLEKNNLQLKKAVVCYIQFGDGSAPWVVGENCILERDAIRIKNELETNEKVLIVGLDDIVG