P57587 AF NFT

30S ribosomal protein S19

MOLNFT AF v1 smart contract in GenesisL1 blockchain:
0xBf7491af3407816DFa88a5EA4c82e8A2B1D721eD
IPFS of NFT metadata:
bafybeicxsulhijkueqw4fyoyymhsvvw736tzjvx7aeo74f7bydvyun7adq/metadata.json
IPFS of structure file:
bafybeib76tfwqiiajplid4lvhbili22k2npjyxxjtjj4higgicdlr3tc3u/AF-P57587-F1-model_v2.pdb
First NFT owner address (eip-55):
0x075C02A666A0C5e777e19513919077eafC193ADd
First NFT owner address (bech32):
genesis1qawq9fnx5rz7walpj5feryrhat7pjwkawrw2u2
Current NFT ID #401139 owner (web3):

First owner GALLERY | EVM EXPLORER | COSMOS EXPLORER

MOLNFT P57587 research and analysis (ICN3D with VR)

FASTA sequences

>sp|P57587|RS19_BUCAI 30S ribosomal protein S19 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) OX=107806 GN=rpsS PE=3 SV=1 MPRSLKKGPFIDISLLKKVEKSVKINDKKPIKTWSRRSTIFPNMVGLTISIHNGRSHIPVFVTEEMVGHKLGEFSLTRTYRGHTADKKVKKR