P16225 AF NFT
Sodium/potassium ATPase inhibitor SPAI-2
MOLNFT AF v1 smart contract in GenesisL1 blockchain:
0xBf7491af3407816DFa88a5EA4c82e8A2B1D721eDIPFS of NFT metadata:
bafybeichszt7t2oyiqf3csuxydtfqdskojwzw2xowfqmwt5zwxhhmjo72a/metadata.jsonIPFS of structure file:
bafybeigyprrghkvxqpjdkghseiifcdrso6uhhpkdpkcc3rebihz5laio3m/AF-P16225-F1-model_v2.pdbFirst NFT owner address (eip-55):
0xaf4ABF15a4d74bcB5a3C972147FC3C36D9b5083EFirst NFT owner address (bech32):
genesis14a9t79dy6a9ukk3ujus50lpuxmvm2zp7ggal47Current NFT ID #433649 owner (web3):
First owner GALLERY | EVM EXPLORER | COSMOS EXPLORER
MOLNFT P16225 research and analysis (ICN3D with VR)
FASTA sequences
>sp|P16225|SPAI_PIG Sodium/potassium ATPase inhibitor SPAI-2 OS=Sus scrofa OX=9823 PE=1 SV=2 MRSRSFLVLVAVFLICETLVAQRLDRIRGPKGQGQDPVEGQDQDEGPGPVKVEILDIGQDPVKGQDPVKGQDPVKGQDPVKGQDLVKSQDPVKAELPDIGQDVVKGHEPVEGQDPVNAQLPDKVQDPVKAQPAVPGRFLLSKRGHCPRILFRCPLSNPSNKCWRDYDCPGVKKCCEGFCGKDCLYPK