C5CGF0 AF NFT
Putative regulatory protein Kole_1849
MOLNFT AF v1 smart contract in GenesisL1 blockchain:
0xBf7491af3407816DFa88a5EA4c82e8A2B1D721eDIPFS of NFT metadata:
bafybeidliqovmteaiez2dee6cbvjcjzy6tkjgek33ozytpjj2rn7tqwkeq/metadata.jsonIPFS of structure file:
bafybeidgvjc7lzcv65ixqv3tcc64v3rfw4d5o3x7dzaicifo6qgr3cb7ua/AF-C5CGF0-F1-model_v2.pdbFirst NFT owner address (eip-55):
0x618720e11Fed616D6c310d644fAC3163CeE987e2First NFT owner address (bech32):
genesis1vxrjpcgla4sk6mp3p4jyltp3v08wnplzfk4xsgCurrent NFT ID #509667 owner (web3):
First owner GALLERY | EVM EXPLORER | COSMOS EXPLORER
MOLNFT C5CGF0 research and analysis (ICN3D with VR)
FASTA sequences
>sp|C5CGF0|Y1849_KOSOT Putative regulatory protein Kole_1849 OS=Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1) OX=521045 GN=Kole_1849 PE=3 SV=1 MYGLINVGFGNVIIGDRVIAIVNPESAPLKRLKEVAKEEGKLIDATYGRKTRAIVITDSNHVILSAIQPETIASRFMQTFTDIEKLLEEIRQAERRTEE