B2SFV9 AF NFT

Ribonuclease H

MOLNFT AF v1 smart contract in GenesisL1 blockchain:
0xBf7491af3407816DFa88a5EA4c82e8A2B1D721eD
IPFS of NFT metadata:
bafybeicsdskyloqyhdxggrgvv2cyspqgxnnhqykfrjx4mzn4vk4t2e572a/metadata.json
IPFS of structure file:
bafybeiawhwjdu4vkvpizieeyhsvqdog7ll5tuqy6ktyg7f67hpcphyuebe/AF-B2SFV9-F1-model_v2.pdb
First NFT owner address (eip-55):
0xfb0568570325C9C3F26f51e3A07C58ee55079e46
First NFT owner address (bech32):
genesis1lvzks4cryhyu8un02836qlzcae2s08jxx48jsy
Current NFT ID #382185 owner (web3):

First owner GALLERY | EVM EXPLORER | COSMOS EXPLORER

MOLNFT B2SFV9 research and analysis (ICN3D with VR)

FASTA sequences

>sp|B2SFV9|RNH_FRATM Ribonuclease H OS=Francisella tularensis subsp. mediasiatica (strain FSC147) OX=441952 GN=rnhA PE=3 SV=1 MEIFKKKNRVIAYTDGACKGNPGIGGWGAILSYNGVDKEIYGSEKDTTNNRMELMAAIKTLQALKRKCDITIYTDSKYLQNGINEWLANWKANGWKTAAKKEVKNKDLWQELDSLTNKHNVTWGWVKGHSGNAGNEKADELANKAIAELIGK