A5GAW9 AF NFT
30S ribosomal protein S19
MOLNFT AF v1 smart contract in GenesisL1 blockchain:
0xBf7491af3407816DFa88a5EA4c82e8A2B1D721eDIPFS of NFT metadata:
bafybeiefbqqugwh4f4hwkzltxao2qbyzzfu3iy3zecjjijzi2dkvcsdzhy/metadata.jsonIPFS of structure file:
bafybeigyeuldektbuszfnpk7qamahfommqrgzufcocyzzfb57mwmghnsdq/AF-A5GAW9-F1-model_v2.pdbFirst NFT owner address (eip-55):
0xaB909Dde3eA43E287fe0Af1fFb1bf6EAc77a9Ed9First NFT owner address (bech32):
genesis14wgfmh375slzsllq4u0lkxlkatrh48ke08ga2fCurrent NFT ID #401344 owner (web3):
First owner GALLERY | EVM EXPLORER | COSMOS EXPLORER
MOLNFT A5GAW9 research and analysis (ICN3D with VR)
FASTA sequences
>sp|A5GAW9|RS19_GEOUR 30S ribosomal protein S19 OS=Geotalea uraniireducens (strain Rf4) OX=351605 GN=rpsS PE=3 SV=1 MARSIKKGPFVDTHLQAKVQAEGPSSKKVIKTWSRRSTITPDFIGLTFAVHNGRKFIPVFVTENMVGHKMGEFAPTRTFFGHAADKKSKLKKK